PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004498202.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 283aa    MW: 32350.9 Da    PI: 8.5484
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004498202.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.3e-321972255
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    prlrWtpeLH++Fv a+e LGG++kAtPk +l+lm+vkgLt++hvkSHLQ+YR+
  XP_004498202.1 19 PRLRWTPELHRCFVYAIETLGGHQKATPKLVLQLMDVKGLTISHVKSHLQMYRS 72
                    8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.4421575IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-311575IPR009057Homeodomain-like
SuperFamilySSF466891.16E-151774IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-231972IPR006447Myb domain, plants
PfamPF002492.0E-72071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGSCGREGVV RQYVRSKVPR LRWTPELHRC FVYAIETLGG HQKATPKLVL QLMDVKGLTI  60
SHVKSHLQMY RSMRSDLCKQ DRTSSVHKRQ SFQEHDEVND VGVLSFLESI GKESDSLFTC  120
RNFSPKRARI EKTSNFLTGI LQCSQRICEA DPNPYTTFYD YVQDMVEQQQ KGIKEICVGS  180
IWQTQPQYCN IFPMLPKQDT HLFQVTKLKE KKHVNEIGKT KSVRAEDEEI GDCELSLSIS  240
LPHLSPQRSN VSSANDIKDS GFRNYMGCST VQNRINLDLS LAI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004498202.10.0PREDICTED: uncharacterized protein LOC101495986 isoform X1
TrEMBLA0A072TFN81e-165A0A072TFN8_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA20G00861.11e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55393353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.11e-34G2-like family protein